PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cre01.g025050.t1.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas
Family GATA
Protein Properties Length: 745aa    MW: 74746.3 Da    PI: 7.1616
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cre01.g025050.t1.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA50.72.4e-16693724132
                GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrk 32 
                         C++Cgt +Tp WR gp g+ktLCnaCG++y k
  Cre01.g025050.t1.2 693 CTQCGTQTTPVWRAGPHGPKTLCNACGVRYMK 724
                         *****************************966 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF577161.14E-12686727No hitNo description
PROSITE profilePS5011412.189687722IPR000679Zinc finger, GATA-type
SMARTSM004012.0E-14687741IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.102.8E-13691724IPR013088Zinc finger, NHR/GATA-type
PfamPF003202.0E-14693724IPR000679Zinc finger, GATA-type
PROSITE patternPS003440693718IPR000679Zinc finger, GATA-type
CDDcd002022.48E-11693722No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 745 aa     Download sequence    Send to blast
MAMFDEGEGG LFGDLFVSNV PCLAGELELQ VQSYECGGDT LPVGDASAAG KSFSLTKDSN  60
GSSLSALGAG GFGDGDFMDG VSLDDIAAAD HYGHTVCGRQ STADSAARHP APLGTSWNAA  120
APSRSRAPAP NVPAADPQHG HNAHDRQATQ DQHNHNNGHE SSDCDMSHTA GDGESSGVGH  180
GKGLAQGSSH SEASEDNTAG LAACRDEEHI SMPSFGLSLT RLTQSQPSSG KPEPPAAAPI  240
AMQQQEQAMQ EQQAQAATAA AGSSAAAMPR ALSVDNFAMT SATSGPAPAG PAPAADAAGS  300
RAAMYRSFSC VATDTLPIDF SLGYGDGALM GASCSGGGLA FGSRGRSASL NETHLRRQQW  360
LHEGELLAPQ LPPSVSELEL LELPEDPVPL RPFKCASFLG GLNTMADSSL TASAAAAANA  420
AAVRPMTSGM MQFKGAGAAA GVDAGAAAAV ATTTTTTTTT NNGVTVTVKR KIITSPSPLL  480
QQGKGKTRQP AGPAAVAPAG VNLQSPKRAK VGGSSGFGGW QQPGAGGMKV VRSVPSNMNN  540
FLEGVEVTVQ PMGHAGADSV VSPNASSISA STPNAQFGAG PFFDPAAAAR GGSALAAGML  600
APQAVASAAG RGSKSKVAVP PTGVSVPVPP VQGVGPVPPG MIPGLVPGTF MAPGMAFPEA  660
KRPVPSVPKP RKRASPNGNP PKAPAPNPNG HCCTQCGTQT TPVWRAGPHG PKTLCNACGV  720
RYMKVAKSGA TQPAPRRQQQ QHHQ*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Cre.124670.0normal conditions| nutrient deficiency
Cis-element ? help Back to Top
SourceLink
PlantRegMapCre01.g025050.t1.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001689549.10.0predicted protein, partial
TrEMBLA8HQ410.0A8HQ41_CHLRE; Predicted protein (Fragment)
STRINGEDP092870.0(Chlamydomonas reinhardtii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP43691012
Representative plantOGRP6817287
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49300.13e-07GATA transcription factor 16